Cagrilintide 5mg

Description

Strength: 5mg
CAS: 1415456-99-3
Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular weight: 4409 g/mol
Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Synonyms: NN0174-0833, AM833, EX-A10092
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.

Cagrilintide peptide is a synthetic peptide designed to mimic hormones involved in metabolism and appetite regulation. It has a stable structure, making it suitable for research. Cagrilintide carries N-terminal acylation with a γGlu linker and C20 fatty diacid moiety, modifications that extend its half-life to permit once-weekly dosing.

It comes as a lyophilized powder in vials for accurate research use. Cagrilintide for research is mainly studied for its effects on metabolic regulation and its potential applications for weight management.

As of 2025, Cagrilintide has completed Phase 3 clinical trials (REDEFINE 1) demonstrating 11.8% weight loss vs. 2.3% placebo over 68 weeks. The combination product CagriSema (cagrilintide 2.4 mg + semaglutide 2.4 mg) has been submitted to the FDA for approval, with review expected in 2026.

Cagrilintide is not yet FDA-approved but has advanced beyond investigational status based on completed Phase 3 data.

• Purity of ≥95%, ensuring reliable results in experiments.
• Supplied as a lyophilized powder for easy storage and longer shelf life.
• Comes in 5 mg vials for precise dosing in research.
• Studied for its role in metabolism, weight regulation, and appetite control.
• Stable when stored correctly to maintain peptide activity.
• Needs to be stored in a freezer for long-term use.
• Handle with standard laboratory safety precautions.
• For laboratory research use only

Cagrilintide is a long-acting synthetic amylin analog that acts as a dual amylin and calcitonin receptor agonist (AMY1R and CTR agonist), mimicking the naturally occurring hormone amylin. This mechanism is distinct from GLP-1 receptor agonists and operates through complementary metabolic pathways.​

Key mechanisms include:

• Gastric emptying delay: Slows nutrient absorption and reduces postprandial glucose spikes​
• Appetite suppression: Reduces food intake through central hypothalamic pathways​
• Amylin-mediated signaling: Activation of amylin receptors on pancreatic beta cells and neurons​
• Postprandial glucose modulation: Improved blood glucose control through slowed nutrient intake​

Cagrilintide provides distinct weight loss benefits compared to GLP-1 agonists alone through its separate amylin pathway, making it effective for obesity management and potentially for type 2 diabetes when combined with other agents.

Preclinical animal studies have evaluated Cagrilintide at doses ranging from 0.1 to 30 nmol/kg subcutaneously or intravenously in rodent models. Doses of 10 nmol/kg demonstrated significant effects on food intake and glucose metabolism.​

Clinical trials in humans employed 2.4 mg once weekly by subcutaneous injection (REDEFINE 1 trial), which resulted in average weight loss of 11.8% compared to 2.3% placebo over 68 weeks.​

Research observations include:

• Significant weight loss in adults with obesity (11.8% with Cagrilintide vs 2.3% placebo)​
• Improved postprandial glucose control through delayed gastric emptying​
• Reduced food intake and appetite suppression through amylin receptor pathways​
• Favorable tolerability profile with manageable gastrointestinal side effects​
• 6% of patients achieved >15% weight loss vs 4.7% in placebo group​

All dosing information is strictly for research/clinical trial purposes, and clinical efficacy data are limited to the completed REDEFINE 1 trial.

• Storage: Keep cagrilintide in a freezer at –20°C or lower to maintain its stability.
• Reconstitution: After mixing with sterile solvent, store at 2–8°C and use within 5-7 days.
• Avoid freeze-thaw cycles to protect the peptide.
• Handle using aseptic techniques and proper safety protocols.

References

https://pmc.ncbi.nlm.nih.gov/articles/PMC11426299/

https://pubmed.ncbi.nlm.nih.gov/26047429/

https://pmc.ncbi.nlm.nih.gov/articles/PMC9282416/

https://pubmed.ncbi.nlm.nih.gov/22271252/

Compliance Notice

This product is intended for laboratory research use only and is not approved for human or veterinary use.