You must be logged in to post a review.
PNC-27 5mg
Coming soon
Strength: 5mg
CAS: N/A
Chemical Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular weight: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Peptide Sequence: PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Synonyms: PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
This product isn't available in your region. Please contact our sales team to explore available alternatives.
Log in or sign up to get notified when this product becomes available.
Log In / Sign UpPNC-27 is a synthetic peptide studied for its interaction with cell membrane signaling in oncology-related research. Research suggests that it may influence cellular apoptosis mechanisms, primarily through interactions with membrane-associated pathways involved in cell cycle regulation.
Disclaimer : Available as lyophilized (freeze-dried) powder for laboratory and in vitro research applications. Reconstitution solution is not included in the pack.
Purity ≥99%
Made in USA
Research Use Only
Fast Shipping
The Novera Compounds Advantage
Made in the USA
Manufactured in the United States under controlled standards. Reliable production. Dependable supply. No overseas uncertainty.
High Purity — 99% or Better
Every batch meets ≥99% purity specifications and is verified by independent third-party laboratory testing. Clean. Consistent. Documented.
Advanced Lyophilized Stability
Carefully lyophilized for structural integrity and easier handling. No cold shipping required. No dry ice. No complications.
Designed for Research
Ideal for scientific study, analytical testing, and research workflows where consistency and quality matter most.
Smart Pricing. Real Value.
High purity. USA-made. Third-party tested. Priced to make sense.
Everything in One Order
Already ordering other products? Add peptides to the same shipment. One vendor. One contact person. Simple.
Product Description
Specifications
Description
Strength: 5mg
CAS: N/A
Chemical Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular weight: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Peptide Sequence: PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Synonyms: PNC‑27; p53(12–26)–penetratin/MRP chimera; HDM2‑targeted lytic peptide
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
PNC-27 (5mg) About This Product
PNC-27 (5mg) is a synthetic peptide composed of a p53-HDM-2 binding domain corresponding to residues 12–26 of the p53 tumor suppressor protein, combined with a membrane-targeting sequence to support cellular interaction in laboratory models. The PNC-27 peptide has a molecular weight of 4,031.7 Daltons (approximately 4.0 kDa) and molecular formula C₁₈₈H₂₉₃N₅₃O₄₄S. It is produced through solid-phase peptide synthesis to support consistency and structural integrity.
This product is supplied as a high-purity, lyophilized powder in a sealed research vial. In published preclinical literature, PNC-27 is used as a mechanistic research tool to investigate HDM-2/MDM2 membrane-associated behavior and peptide interaction patterns in experimental systems. Observations are specific to the experimental models used, such as in-vitro cell systems or isolated membrane preparations, and should be interpreted only within that context.
PNC-27 (5mg) Key Features and Benefits
- High-purity synthetic peptide suitable for laboratory research
- Supplied as a 5 mg lyophilized powder in a sealed vial
- Studied in laboratory research for investigating tumor-selective interactions with cancer cell membranes
- Peptide sequence includes a p53-derived HDM-2 binding domain
- Suitable for in vitro and preclinical research applications
- Stable under recommended cold-storage conditions
- Commonly included in research workflows where laboratories buy PNC-27 peptide for controlled experimental use
- For laboratory research use only
PNC-27 (5mg) Mechanism & Research Applications
PNC-27 is being investigated as a mechanistic probe to study peptide–HDM-2/MDM2 binding behavior and membrane-associated localization phenomena. Research focuses on how the peptide associates with HDM-2-related targets expressed on cancer cell membranes, leading to selective interactions under controlled laboratory conditions.
Research applications focus on examining peptide–protein binding interactions involving HDM-2/MDM2-associated motifs, assessing peptide localization to membrane compartments, and investigating selective pore formation and membrane destabilization in cancer cell models. Studies explore structure–function relationships within the p53-derived binding region using controlled experimental formats. Research also examines peptide-induced signaling mechanisms and apoptotic pathways in experimental cancer cell systems.
Experimental approaches commonly employed include peptide–protein binding assays, microscopy-based localization studies, biochemical membrane fractionation methods, and structure–function analysis frameworks designed to characterize p53-derived interaction domains.
PNC-27 (5mg) Dosing & Observed Effects in Research
Published research involving PNC-27 describes a range of experimental concentrations that vary by study design, cell type, and exposure duration. Dosing is commonly expressed as micromolar concentrations and applied in vitro to evaluate peptide–HDM-2 binding behavior and membrane localization patterns under controlled laboratory conditions.
Observed endpoints include binding readouts, localization signals, membrane-interaction signatures, and changes in cellular morphology or viability markers, measured using established laboratory assays. These findings support further mechanistic investigation rather than clinical interpretation. Laboratories that order PNC-27 peptide use these data to refine experimental design and comparative analysis.
PNC-27 (5mg) Storage, Safety & References
PNC-27 (5mg) should be stored in its lyophilized form at –20°C or lower, protected from light and moisture. Reconstituted solutions should be prepared using sterile laboratory techniques and aliquoted to limit repeated freeze–thaw cycles.
This product is intended for use by trained research personnel in controlled laboratory environments and should be handled according to standard laboratory safety procedures and institutional research guidelines.
References
https://pubmed.ncbi.nlm.nih.gov/20080680/
https://pubmed.ncbi.nlm.nih.gov/35625682/
https://www.sciencedirect.com/science/article/abs/pii/S1072751509008783
https://pubmed.ncbi.nlm.nih.gov/38802154/
Compliance Notice
This product is intended for laboratory research use only and is not approved for human or veterinary use.




Reviews
There are no reviews yet.